PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400046162
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 157aa    MW: 18357 Da    PI: 9.4358
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400046162genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.53.7e-28252151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+ rqvtfskRr g+lKK +E+SvLCda+va+i+fss+gkl+eys+
  PGSC0003DMP400046162  2 KRIENKISRQVTFSKRRSGLLKKTNEISVLCDADVALIVFSSNGKLFEYST 52
                          79***********************************************96 PP

2K-box73.37.2e-2570140876
                 K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76 
                           +  l+++  e+++ e+ kL +++e Lqr++Rh++GedL+  +l+e q LeqqL+++lk++Rs+K +++++ 
  PGSC0003DMP400046162  70 ErnLNTTYKENWTLEYPKLMARVELLQRNIRHFMGEDLDAFNLREFQGLEQQLDTALKRVRSRKRDMFCKF 140
                           224888999********************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.137154IPR002100Transcription factor, MADS-box
CDDcd002651.08E-35169No hitNo description
SuperFamilySSF554556.54E-30182IPR002100Transcription factor, MADS-box
SMARTSM004329.4E-29153IPR002100Transcription factor, MADS-box
PfamPF003193.8E-25350IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-161631IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-163152IPR002100Transcription factor, MADS-box
PfamPF014866.3E-1976138IPR002487Transcription factor, K-box
PROSITE profilePS5129711.20178156IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MKRIENKISR QVTFSKRRSG LLKKTNEISV LCDADVALIV FSSNGKLFEY STQSSMENIL  60
ERYESYSSAE RNLNTTYKEN WTLEYPKLMA RVELLQRNIR HFMGEDLDAF NLREFQGLEQ  120
QLDTALKRVR SRKRDMFCKF VAHGEALKEL KQICDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-16166771Myocyte-specific enhancer factor 2A
3mu6_B2e-16166771Myocyte-specific enhancer factor 2A
3mu6_C2e-16166771Myocyte-specific enhancer factor 2A
3mu6_D2e-16166771Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754417e-58HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755147e-58HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006365655.12e-93PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_006365654.12e-93PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ9SBK92e-60CAL_BRARP; Transcription factor CAULIFLOWER
SwissprotQ6R4S62e-60CAL_BRARC; Transcription factor CAULIFLOWER
SwissprotQ6R4S32e-60CAL_BRARR; Transcription factor CAULIFLOWER
TrEMBLM1CIV01e-113M1CIV0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000683258e-93(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.15e-61MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]